PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009767411.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 226aa    MW: 25186.4 Da    PI: 9.718
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009767411.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA93.82.1e-2970126158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy++Il+RRq Rak+  e+k+  ksrkpylheSRh+hA+rR+R  gGrF
  XP_009767411.1  70 EEPMYVNAKQYHGILRRRQLRAKAVLEQKV-VKSRKPYLHESRHRHAMRRARDGGGRF 126
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.3E-3368129IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.79269129IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.1E-2671126IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.1E-227294IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.1E-22103126IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MPPIMGENLK AANQFELMAP SIAFKSYPYS EVPQYSGGNV AAACGESLVH QNIERSVHNG  60
RMILPIEVKE EPMYVNAKQY HGILRRRQLR AKAVLEQKVV KSRKPYLHES RHRHAMRRAR  120
DGGGRFLNTK KKIQLPANNN INTTTPSSKG KGCAASEVSS MDSDFSQNYL LNSGHIGSSN  180
ATSVEGFQFQ GIHNTDNPQL GCHYQWNLND NHCNCMQSGA SNLQPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-2070132264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110119RHRHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767412.11e-171PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_009767411.11e-171PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_009767410.11e-171PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
TrEMBLK4D2F61e-102K4D2F6_SOLLC; Uncharacterized protein
STRINGSolyc10g079150.1.11e-101(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.44e-30nuclear factor Y, subunit A1